PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g018450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 283aa    MW: 31469.7 Da    PI: 10.2698
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g018450.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind3642.9e-11112821301
       GAGA_bind   1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdaki....rernlalsekkaavaerd....maflqrdkalaernkalverdnkllalll 86 
                     mdddg+  rn+gyyepa a++k nlglqlms+i +r++k+    r+ nl ++++++++++++    m++    +++++       +++k++++l+
  Csa03g018450.1   1 MDDDGF--RNWGYYEPAaATFKGNLGLQLMSTI-DRNTKPflpgRDPNL-MIGPNGSYHHQEppihMSY----NWINQ-------QKDKFFNMLP 80 
                     99**99..9*******999**************.9**************.************5555555....*****.......899******* PP

       GAGA_bind  87 venslasalpvgvqvlsgtksidslqq..lsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvk 179
                     v+++     p++ +vl++t+s+ s+q+  ++++q+e+++v + e       +    ++++k++k+++k  +a+++k+kk +k+k+++++++++++
  Csa03g018450.1  81 VTTA-----PNYGNVLPETSSAPSMQMnlHHHHQTEENPVVKLE------DE---VVQTNKKRKTNSKAGSATTTKAKKPRKPKDENTNNNNNNN 161
                     9997.....9*****************74455777777776222......22...3345566667777789999***********8888887777 PP

       GAGA_bind 180 kesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaa 274
                     ++++ +r+k  kks+d+v+ngvs+D+s+lPvPvC+CtGa++qCY+WG+GGWqSaCCtt+iS++PLP+stkrrgaRi+grKmSqgafkk+LekLa+
  Csa03g018450.1 162 TNNV-SRVKPAKKSVDMVINGVSMDISGLPVPVCTCTGAPQQCYRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLAS 255
                     7776.7***************************************************************************************** PP

       GAGA_bind 275 eGydlsnpvDLkdhWAkHGtnkfvtir 301
                     +G++++np+DLk+hWA+HGtnkfvtir
  Csa03g018450.1 256 DGFNFGNPIDLKSHWARHGTNKFVTIR 282
                     **************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012264.7E-1731282IPR010409GAGA-binding transcriptional activator
PfamPF062173.1E-1001282IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MDDDGFRNWG YYEPAAATFK GNLGLQLMST IDRNTKPFLP GRDPNLMIGP NGSYHHQEPP  60
IHMSYNWINQ QKDKFFNMLP VTTAPNYGNV LPETSSAPSM QMNLHHHHQT EENPVVKLED  120
EVVQTNKKRK TNSKAGSATT TKAKKPRKPK DENTNNNNNN NTNNVSRVKP AKKSVDMVIN  180
GVSMDISGLP VPVCTCTGAP QQCYRWGCGG WQSACCTTNI SMHPLPMSTK RRGARISGRK  240
MSQGAFKKVL EKLASDGFNF GNPIDLKSHW ARHGTNKFVT IR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0069170.0AC006917.6 Genomic sequence for Arabidopsis thaliana BAC F10B6 from chromosome I, complete sequence.
GenBankAC0106570.0AC010657.3 Genomic sequence for Arabidopsis thaliana BAC T5E21 from chromosome I, complete sequence.
GenBankAY0580730.0AY058073.1 Arabidopsis thaliana At1g14680/F10B6_22 mRNA, complete cds.
GenBankAY0903050.0AY090305.1 Arabidopsis thaliana At1g14680/F10B6_22 mRNA, complete cds.
GenBankAY3805680.0AY380568.1 Arabidopsis thaliana basic pentacysteine 2 (BPC2) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010496399.10.0PREDICTED: protein BASIC PENTACYSTEINE2 isoform X1
RefseqXP_010496393.10.0PREDICTED: protein BASIC PENTACYSTEINE2 isoform X2
RefseqXP_010496390.10.0PREDICTED: protein BASIC PENTACYSTEINE2 isoform X1
SwissprotQ9LDE20.0BPC2_ARATH; Protein BASIC PENTACYSTEINE2
TrEMBLQ2PQR30.0Q2PQR3_9BRAS; GAGA-binding transcriptional activator
STRINGfgenesh2_kg.1__1602__AT1G14685.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28932769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-176basic pentacysteine 2